PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G2726
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 248aa    MW: 28067.4 Da    PI: 8.6181
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G2726genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.5e-172572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEdell +++++ G g+W+t +++ g+ R++k+c++rw +yl
      Gh_A11G2726 25 RGPWTPEEDELLSNYINKEGEGRWRTLPKRAGLLRCGKSCRLRWMNYL 72
                     89******************************99************97 PP

2Myb_DNA-binding47.54e-1583123648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
      Gh_A11G2726  83 PDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 123
                      89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-221674IPR009057Homeodomain-like
PROSITE profilePS5129416.5532072IPR017930Myb domain
SuperFamilySSF466893.56E-2922119IPR009057Homeodomain-like
SMARTSM007172.2E-132474IPR001005SANT/Myb domain
PfamPF002491.5E-152572IPR001005SANT/Myb domain
CDDcd001675.71E-112772No hitNo description
PROSITE profilePS5129424.39773127IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2475128IPR009057Homeodomain-like
SMARTSM007172.7E-1377125IPR001005SANT/Myb domain
PfamPF002496.7E-1483123IPR001005SANT/Myb domain
CDDcd001672.75E-1183123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MRNPTKKDNV GTKTTPCCSK VGLKRGPWTP EEDELLSNYI NKEGEGRWRT LPKRAGLLRC  60
GKSCRLRWMN YLRPSVKRGQ IAPDEEDLIL RLHRLLGNRW SLIAGRIPGR TDNEIKNYWN  120
THLSKKLISQ GIDPRTHKPL NPQQLSPSPP SLKPSPSSSS SMAKPNNPPS PLPVHVVNAN  180
KQNDYDDGSN EDHQGMIMNN DHYQQQQDHD DDVFSSFLNS LINEDDDALV SNLGLSQGWE  240
STPFDQPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25231275108B-MYB
1h8a_C8e-252312725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.80761e-168boll| leaf
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3362780.0AF336278.1 Gossypium hirsutum BNLGHi233 (bnlghi6233) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434848.10.0PREDICTED: transcription repressor MYB5-like
SwissprotQ388504e-89MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A0D2SPS80.0A0A0D2SPS8_G
STRINGPOPTR_0001s04240.12e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.16e-80myb domain protein 5